thiol is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Updated 2025-12-14. Numbers and descriptions here follow the published literature rather than marketing material.
Quality control for glutathione materials checks identity, assay, purity, water content, and disulfide content. Commercial products vary from research-grade powder to dietary supplements, and labels may not distinguish reduced from oxidized forms. In the United States, oral glutathione is commonly sold as a dietary supplement rather than an approved drug, while injectable forms fall under different rules and may require a prescription. Regulatory status differs by country. Analytical certificates, when available, help verify what a material contains, but independent testing remains important for interpretation.
Laboratory measurement of glutathione typically starts with rapid acid extraction to prevent oxidation and enzymatic degradation. Common methods include enzymatic recycling assays, high-performance liquid chromatography, and liquid chromatography coupled with mass spectrometry. The recycling assay uses glutathione reductase and a thiol-reactive colorimetric or fluorescent reagent, measuring total glutathione after converting disulfide forms. Chromatographic methods can separate reduced and oxidized forms, which helps when the redox ratio is the target. Choice of method affects sensitivity, specificity, and the amount of sample needed.
Glutathione is present in most tissues, with especially high concentrations in the liver. It also serves as a cofactor for some enzymes and helps transport amino acids across cell membranes. In plants and microorganisms, glutathione contributes to stress responses and metal handling. The molecule is synthesized in two ATP-dependent steps, first producing gamma-glutamylcysteine and then adding glycine. Because cysteine availability often limits synthesis, dietary and metabolic factors can influence glutathione levels. Research continues to examine how these levels relate to health and disease.
Glutathione is a tripeptide composed of glutamate, cysteine, and glycine. The peptide bond between glutamate and cysteine uses the gamma-carboxyl group of glutamate rather than the alpha-carboxyl group. This unusual linkage protects the molecule from many common peptidases. The cysteine side chain carries a thiol group that can undergo reversible oxidation. Because of this thiol, glutathione participates in redox reactions and helps maintain the reducing environment inside most cells in living systems.
| Property | Value | Notes |
|---|---|---|
| Recommended storage | −20 °C, desiccated | For dry powder; limit light and air exposure |
| Solution stability | Hours to days at neutral pH | Faster loss at warm, alkaline, or oxygen-rich conditions |
| Routine measurement | LC-MS/MS or HPLC | Enzymatic recycling assays measure total glutathione |
| Thiol pKa | About 8.7 | The thiolate form reacts with oxidants and electrophiles |
| Common abbreviations | GSH and GSSG | GSSG is the disulfide-linked dimer |
Stability depends on pH, temperature, oxygen exposure, and trace metals. Aqueous solutions of reduced glutathione are susceptible to oxidation, especially when neutral or alkaline and exposed to air. Transition metal ions can catalyze thiol oxidation, so chelators and inert atmospheres are sometimes used in research settings. Standards are typically stored cold and desiccated, with limited freeze-thaw cycles. Questions remain about how closely in vitro stability data reflect the behavior of glutathione within intact cells and tissues.
Measuring glutathione requires attention to oxidation during sample handling, because GSH in biological samples can convert to GSSG or form mixed disulfides with proteins after collection. Acidic extraction, rapid cooling, and chelating agents are commonly used to limit such changes. Analytical methods usually distinguish free reduced glutathione, total glutathione, and protein-bound forms. Because these forms have different stability and reactivity, reported values depend heavily on the preparation protocol. No single preparation is universally suitable for every biological matrix or analytical goal.
Several techniques are used for quantification. Enzymatic recycling assays rely on glutathione reductase and a colorimetric or fluorescent readout, offering sensitivity for total glutathione. High-performance liquid chromatography can separate GSH from GSSG and other thiols, often with UV, fluorescence, or electrochemical detection. Mass spectrometry provides structural confirmation and can quantify low-abundance species when paired with separation. Each approach has trade-offs in specificity, throughput, and equipment requirements, so method selection depends on the research question and available instrumentation.
Glutathione participates in detoxification reactions, amino acid transport, and the maintenance of protein thiols. It serves as a cofactor for several enzymes, including glutathione peroxidases and glutathione S-transferases. In research literature, altered glutathione status appears in studies of aging, infection, metabolic stress, and environmental exposure. Whether low glutathione is a cause, consequence, or marker of such conditions often remains unresolved. Direct measurement in blood or tissue provides a snapshot, but results depend on sample handling, timing, and the method used.
Glutathione is a small tripeptide made of glutamic acid, cysteine, and glycine. Its cysteine thiol group allows reversible oxidation and reduction, making it central to cellular redox chemistry. The reduced form, often abbreviated GSH, predominates inside most cells, while the oxidized disulfide form, GSSG, forms when two GSH molecules react. The ratio of GSH to GSSG is widely used as an indicator of oxidative stress in laboratory research, though it does not by itself diagnose a clinical condition.
Biosynthesis occurs in two ATP-dependent steps. The enzyme glutamate-cysteine ligase joins glutamate and cysteine, forming gamma-glutamylcysteine; glutathione synthetase then adds glycine to produce the complete tripeptide. Because the peptide bond from glutamate uses the gamma-carboxyl group, glutathione resists digestion by many ordinary peptidases. Tissues vary in synthesis capacity, and the liver generally contains high concentrations relative to many other organs. This uneven distribution contributes to organ-specific differences in redox buffering and affects how experimental results are interpreted across tissue types.
Amylin, or islet amyloid polypeptide (IAPP), is a 37-residue peptide hormone. It is co-secreted with insulin from the pancreatic β-cells in the ratio of approximately 100:1 (insulin:amylin). Amylin plays a role in glycemic regulation by slowing gastric emptying and promoting satiety, thereby preventing spikes in blood glucose levels after a meal. IAPP is processed from an 89-residue coding sequence. Proislet amyloid polypeptide (proIAPP, proamylin, proislet protein) is produced in the pancreatic beta cells (β-cells) as a 67 amino acid, 7404 Dalton pro-peptide and undergoes post-translational modifications including protease cleavage to produce amylin.
In addition to killing bacteria directly they have been demonstrated to have a number of immunomodulatory functions that may be involved in the clearance of infection, including the ability to alter host gene expression, act as chemokines and/or induce chemokine production, inhibiting lipopolysaccharide induced pro-inflammatory cytokine production, promoting wound healing, and modulating the responses of dendritic cells and cells of the adaptive immune response. Animal models indicate that host defense peptides are crucial for both prevention and clearance of infection. It appears as though many peptides initially isolated as and termed "antimicrobial peptides" have been shown to have more significant alternative functions in vivo (e.g. hepcidin). Dusquetide for example is an immunomodulator that acts through p62, a protein involved in toll like receptor based signalling of infection. The peptide is being examined in a Phase III clinical trial by Soligenix (SGNX) to ascertain if it can assist in repair of radiation-induced damage to oral mucosa arising during cancer radiotherapy of the head and neck.
In organic chemistry, an amide, also known as an organic amide or a carboxamide, is a compound with the general formula R−C(=O)−NR′R″, where R, R', and R″ represent any group, typically organyl groups or hydrogen atoms. The amide functional group plays an important role in the chemistry of life where, as peptide bonds, they link amino acids together to form proteins. Amides can be viewed as a derivative of a carboxylic acid (R−C(=O)−OH) with the hydroxyl group (−OH) replaced by an amino group (−NR′R″); or, equivalently, an acyl (alkanoyl) group (R−C(=O)−) joined to an amino group. Common amides are formamide (H−C(=O)−NH2), acetamide (H3C−C(=O)−NH2), benzamide (C6H5−C(=O)−NH2), and dimethylformamide (H−C(=O)−N(−CH3)2). Amides are qualified as primary, secondary, and tertiary according to the number of acyl groups bounded to the nitrogen atom.
The biosynthesis of mycofactocin from its precursor peptide MftA begins with decarboxylation of the C-terminal tyrosine residue by the radical SAM enzyme MftC, with help from the precursor-binding protein MftB. However, MftC appears next to perform a further modification to the MftA precursor peptide, an easily missed isomerization, by introducing a tyramine-valine cross-link, and consuming another S-adenosylmethionine in the process. The need for two modifications to MftA by MftC might explain the high degree of amino acid conservation in the last eight residues of MftA, as compared to the level of conservation seen for PqqA, precursor of PQQ. Next, the creatininase homolog MftE releases the C-terminal dipeptide, VY* (valine-tyrosine, where * indicates that the tyrosine was previously modified). Next, MftD converts the VY-derived dipeptide to premycofactocin, which has a biologically active redox center. And lastly, the glycosyltransferase MftF builds onto premycofactocin a variably sized, beta-1,4 linked oligomeric chain of glucose (i.e. cellulose), sometimes substituting derivatives such as 2-O-methylglucose. Mycofactocin, therefore, is not a single compound, but instead a mixture of closely related electron carriers that differ in the nature of their attached oligosaccharides.
In jaundice owing to hemolysis (prehepatic, or hemolytic, jaundice), the pathophysiology is that overproduction of bilirubin from the extravascular or intravascular hemolysis overwhelms the capacity of the liver to excrete it. The bilirubin present in the plasma is largely unconjugated in this setting as they haven't been taken up and conjugated by the liver. In this case, total serum bilirubin increases while the ratio of direct bilirubin to indirect bilirubin remains 96 to 4 as up to 96%-99% of bilirubin in the bile are conjugated mentioned above. Although there were some studies that showed an inverse correlation between serum bilirubin level and prevalences of ischemic coronary artery disease, cancer mortality, or colorectal cancer in general population, the potential benefits of the chemopreventive function of bilirubin and their causative relations haven't been proved.
Sources: en.wikipedia.org
The iron-containing co-factor is found tightly associated with the protein. It can be released upon denaturation with 2-mercaptoethanol or guanidine hydrochloride. Expression of the Hmd gene in E. coli without the co-factor results in an inactive holoenzyme. However, hydrogenase activity can be rescued by the addition of the iron-containing cofactor taken from denatured active enzyme. As mentioned, irradiation of the cofactor with UV light results in the loss of CO and Fe. In addition the 542 Da compound can be further degraded by a phosphodiesterase (which specifically cleaves phosphate bonds). Hydrolysis of the phosphate bonds generates the ribonucleotide guanosine monophosphate and a modified 2-pyridone. On the basis of spectroscopic characterization, Shima et al. have proposed a structure for this organic cofactor (minus the iron atom and CO molecules) as shown:
Arrestins (abbreviated Arr) are a small family of proteins important for regulating signal transduction at G protein-coupled receptors. Arrestins were first discovered in the late '80s as a part of a conserved two-step mechanism for regulating the activity of G protein-coupled receptors (GPCRs) in the visual rhodopsin system by Hermann Kühn, Scott Hall, and Ursula Wilden and in the β-adrenergic system by Martin J. Lohse and co-workers.
NETA is used as a hormonal contraceptive in combination with estrogen, in the treatment of gynecological disorders such as abnormal uterine bleeding, and as a component of menopausal hormone therapy for the treatment of menopausal symptoms. NETA is available in the form of tablets for use by mouth both alone and in combination with estrogens including estradiol, estradiol valerate, and ethinylestradiol. Transdermal patches providing a combination of 50 μg/day estradiol and 0.14 or 0.25 mg/day NETA are available under the brand names CombiPatch and Estalis. NETA was previously available for use by intramuscular injection in the form of ampoules containing 20 mg NETA, 5 mg estradiol benzoate, 8 mg estradiol valerate, and 180 mg testosterone enanthate in oil solution under the brand name Ablacton to suppress lactation in postpartum women. Side effects of NETA include menstrual irregularities, headaches, nausea, breast tenderness, mood changes, acne, increased hair growth, and others.
Artificially acquired passive immunity is a short-term immunization induced by the transfer of antibodies, which can be administered in several forms; as human or animal blood plasma, as pooled human immunoglobulin for intravenous (IVIG) or intramuscular (IG) use, and in the form of monoclonal antibodies (MAb). Passive transfer is used prophylactically in the case of immunodeficiency diseases, such as hypogammaglobulinemia. It is also used in the treatment of several types of acute infection, and to treat poisoning. Immunity derived from passive immunization lasts for only a short period of time, and there is also a potential risk for hypersensitivity reactions, and serum sickness, especially from gamma globulin of non-human origin. The artificial induction of passive immunity has been used for over a century to treat infectious disease, and before the advent of antibiotics, was often the only specific treatment for certain infections. Immunoglobulin therapy continued to be a first line therapy in the treatment of severe respiratory diseases until the 1930s, even after sulfonamide lot antibiotics were introduced.
Clostridium tetani produces tetanus toxin (TeNT protein), which leads to a fatal condition known as tetanus in many vertebrates (including humans). Tetanus toxin is produced from Clostridium tetani, a spore forming bacteria commonly found in soil, Tetanus is a paralytic disease that commonly affects newborns and non-immunized individuals. Tetanus enters the body of organisms through wounds or skin breaks and can be found in manure, soil, and dust. Tetanus mechanism includes tetanus preventing the transmission of glycine and γ-aminobutyric acid from inhibitory interneurons in the spinal cord, leading to activation of motor neurons causing contraction (known as spastic paralysis). It can also cause dysautonomia through a similar process that leads to autonomic dysinhibition. When tetanus toxin enters the body it is taken up by cholinergic nerve endings travel through axons into the spinal cord, the toxin is subsequently released from motor neurons and reuptaken into inhibitory nerve terminals triggering loss of inhibition and exaggerated reflexes in intoxicated individuals. Tetanus intoxication is a vaccine preventable illness.
Sources: en.wikipedia.org
36. Georgian Med News. 2006 Apr;(133):111-5. Anti-aging peptide bioregulators induce reactivation of chromatin. Lezhava T(1), Monaselidze J, Kadotani T, Dvalishvili N, Buadze T. Author information: (1)Tbilisi State University. The effect of synthetic peptide bioregulators (Epitalon, Livagen and Vilon) on structural and facultative heterochromatin of cultivated lymphocytes have been studied among old (75-88yr.) people. The data obtained indicate that epitalon, livagen and vilon: 1) activate synthetic processes, caused by reactivation of ribosomal genes as a result of deheterochromatinization (decondensation) of nucleolus organizer regions; 2) induce unrolling (deheterochromatinization) of total heterochromatin; 3) release genes repressed by heterochromatinization (condensation) of euchromatic regions forming facultative heterochromatin; 4) epitalon and livagen induce deheterochromatinization (decondensation) of pericentromeric structural heterochromatin of the chromosomes1 and 9. However, vilon does not induce deheterochromatinization of pericentromeric structural heterochromatin. These results indicate that peptide bioregulators Epitalon, Livagen and Vilon cause activation (deheterochromatinization) of chromatin in lymphocytes of old individuals.
The formation of amino acids and peptides is assumed to have preceded and perhaps induced the emergence of life on earth. Amino acids can form from simple precursors under various conditions. Surface-based chemical metabolism of amino acids and very small compounds may have led to the build-up of amino acids, coenzymes and phosphate-based small carbon molecules. Amino acids and similar building blocks could have been elaborated into proto-peptides, with peptides being considered key players in the origin of life.
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
Annals of Clinical Biochemistry is a bimonthly peer-reviewed scientific journal covering all aspects of clinical biochemistry. The editor-in-chief is Michael J Murphy (University of Dundee). It was established 1960 and is published by SAGE Publications on behalf of The Association for Clinical Biochemistry and Laboratory Medicine. The journal is abstracted and indexed in: According to the Journal Citation Reports, its 2012 impact factor is 1.922, ranking it 12th out of 31 journals in the category "Medical Laboratory Technology". Official website
Soy-based food products, such as soybeans, miso, tempeh, tofu, meatless soy burgers, and soy protein infant foods contain the highest amounts of isoflavones. According to a 2006 study of nine common phytoestrogens in Canadian foods, the highest relative phytoestrogen content were nuts and oilseeds, followed by soy products, cereals and breads, legumes, meat products, and other processed foods that may contain soy, vegetables, fruits, alcoholic, and nonalcoholic beverages. The highest concentrations of isoflavones are found in soybeans and soybean products followed by legumes, whereas lignans are the primary source of phytoestrogens found in nuts and oilseeds (e.g. flax) and also found in cereals, legumes, fruits and vegetables. Phytoestrogen content varies in different foods, and may vary significantly within the same group of foods (e.g. soy beverages, tofu) depending on processing mechanisms and type of soybean used. Legumes (in particular soybeans), whole grain cereals, and some seeds are high in phytoestrogens. Food content of phytoestrogens is highly variable, and accurate estimates of intake are therefore difficult and depends on the databases used. Data from the European Prospective Investigation into Cancer and Nutrition found intakes between 1 mg/d in Mediterranean Countries and more than 20 mg/d in the United Kingdom.
Sources: pubmed.ncbi.nlm.nih.gov
Common approaches include enzymatic recycling assays, HPLC, and LC-MS/MS. Acid extraction and rapid processing limit oxidation before analysis.
Reduced glutathione oxidizes easily and can change after collection. Delays, warmth, light, and repeated freezing can alter measured values.
Labels may state total glutathione without specifying reduced and oxidized content. Purity, counterions, and actual assay can vary between products.
Glutathione is a tripeptide made from glutamate, cysteine, and glycine. Its cysteine residue provides a thiol group that is central to its redox activity. The glutamate-cysteine bond forms through the gamma-carboxyl group of glutamate.